PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf01674g02007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family M-type_MADS
Protein Properties Length: 117aa    MW: 12774.4 Da    PI: 4.4326
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf01674g02007.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF391e-12350249
                              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                              +ie++  r   f k +  +l  A+ELSv+++aev vi++s++gk y+y
  Peinf101Scf01674g02007.1  3 KIESEAVRLAAFLKLKSQLLMEAHELSVMTGAEVGVIVYSPSGKPYTY 50
                              69999******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.661154IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-4153IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-15175IPR002100Transcription factor, MADS-box
PfamPF003198.5E-15350IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-51631IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-53152IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MRKIESEAVR LAAFLKLKSQ LLMEAHELSV MTGAEVGVIV YSPSGKPYTY GYLSSFETIL  60
DRFLKWSENR PHDGVDDLQE PVSAASFIDV PASPRTSCVA IDLNVADPDD GESSASH
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14083711
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.12e-13AGAMOUS-like 44